Protein Info for BPHYT_RS01730 in Burkholderia phytofirmans PsJN

Annotation: serine/threonine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF01636: APH" amino acids 47 to 279 (233 residues), 125.5 bits, see alignment E=1.6e-40

Best Hits

Swiss-Prot: 41% identical to SRKA_SALCH: Stress response kinase A (srkA) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0362)

Predicted SEED Role

"Putative homoserine kinase type II (protein kinase fold)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1Q8 at UniProt or InterPro

Protein Sequence (342 amino acids)

>BPHYT_RS01730 serine/threonine protein kinase (Burkholderia phytofirmans PsJN)
MNDDILDPQDSANSAVPFARLKPEIVLDALDSALSTVGVRTDGRMLPLNSYENRVYQVGV
EDGPPVVAKFYRPERWSDAAILEEHAFVAELAAREIPVVAARALDGRTLHTFDGFRFSIF
ERRGGRAPDLDRRDTLEWLGRFIGRIHAVGQTENYAERPTLDIHTFGYEPRDFLLAHRFV
PDDVRTAWETVVNLALEGVERAFERAGDIRMLRMHGDCHPSNVLWTDAGPHFVDFDDSRM
GPAVQDLWLLLPGERVEASRALADLLAGYEDFCDFEPRELYLVEALRTLRLIHYQAWLAR
RWDDPAFPAAFPWFNTQRYWEERILELREQLGAMQEGPLWPV