Protein Info for BPHYT_RS01695 in Burkholderia phytofirmans PsJN

Annotation: L-glyceraldehyde 3-phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF00248: Aldo_ket_red" amino acids 28 to 328 (301 residues), 239.8 bits, see alignment E=1.7e-75

Best Hits

Swiss-Prot: 67% identical to GPR_ECO57: L-glyceraldehyde 3-phosphate reductase (gpr) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0355)

MetaCyc: 67% identical to L-glyceraldehyde 3-phosphate reductase (Escherichia coli K-12 substr. MG1655)
Aldehyde reductase. [EC: 1.1.1.21]; 1.1.1.- [EC: 1.1.1.21]

Predicted SEED Role

"Oxidoreductase, aldo/keto reductase family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1Q1 at UniProt or InterPro

Protein Sequence (347 amino acids)

>BPHYT_RS01695 L-glyceraldehyde 3-phosphate reductase (Burkholderia phytofirmans PsJN)
MAYEAASERYSDMQYRVCGKSGLKLPALSLGLWHNFGDTTPISTQRDILRTAFDLGITHF
DLANNYGPPYGSAETNFGRLFKDDFKPYRDELLISSKAGWDMWPGPYGQGGGSRKYVLAS
LDQSLQRMGLDYVDIFYSHRFDADTPLEETAGALASAVQQGKALYIGISSYSATKTLEMA
KLLAEYKVPLLIHQPAYNMLNRWIEQELLDTLEKVGAGTIAFTPLAQGLLTDKYLNGVPE
DARVNKPGGGSLKQEHLSAQNIEHVRKLNDIAQRRGQSLAQMALAWALRDPRVTSVLIGA
SRAEQVRENVGALKNLAFSKDELAEIDRYATEGGINLWEKPSTDQAI