Protein Info for BPHYT_RS01650 in Burkholderia phytofirmans PsJN

Annotation: 23S rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17785: PUA_3
  • amino acids 4 to 67 (64 residues), 79.5 bits, E=5.6e-26
• PF02475: Met_10
  • amino acids 138 to 274 (137 residues), 26.4 bits, E=2.5e-09
• PF10672: Methyltrans_SAM
  • amino acids 175 to 354 (180 residues), 99.2 bits, E=1.1e-31
• PF05175: MTS
  • amino acids 216 to 340 (125 residues), 27.4 bits, E=1.1e-09
• PF06325: PrmA
  • amino acids 218 to 302 (85 residues), 24.7 bits, E=7.2e-09
• PF03602: Cons_hypoth95
  • amino acids 220 to 306 (87 residues), 40.4 bits, E=1.2e-13
• PF13847: Methyltransf_31
  • amino acids 226 to 360 (135 residues), 31.5 bits, E=6.4e-11
• PF09445: Methyltransf_15
  • amino acids 227 to 308 (82 residues), 24.6 bits, E=7.5e-09
• PF13649: Methyltransf_25
  • amino acids 228 to 303 (76 residues), 28.1 bits, E=1.2e-09

Best Hits

Swiss-Prot: 50% identical to RLMI_SHEPC: Ribosomal RNA large subunit methyltransferase I (rlmI) from Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 100% identity to bpy:Bphyt_0346)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See B2T1P2 at UniProt or InterPro

Protein Sequence (400 amino acids)

>BPHYT_RS01650 23S rRNA methyltransferase (Burkholderia phytofirmans PsJN)
MNTVTLKPSKEKSLLRRHPWVYANAIDRIDGNPAPGATVLVRAHDGRFLARAAYSPHSQI
RARVWSFDESEPIDHAFFKRRVQRALAHRRRMVHDTGAVRLIFGEADGLPGLIVDHYVAE
DEGQRSQLVCQFMAAGVEAWKDAIVAALTGATGCPNVYERSDVSIRQKEGLEQITGVLAG
EAPSEALIASENGVRYHVDVRNGHKTGFYVDQRDNRLLVQQLAQDREVLNCFCYTGGFSL
AALKGGAKRVVSIDSSGDALAIAQQNVAANGFDAERATWLDADAFKTLRRLHDEGERFDL
IVLDPPKFAPSREHVDRASRAYKDINLTGLKLLRPGGLLFTYSCSGAIDAELFQKIVSGA
AADARVDARILKRLGAGVDHPLLTAFPEGEYLKGLLLQIA