Protein Info for BPHYT_RS01620 in Burkholderia phytofirmans PsJN

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 99 to 140 (42 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details PF02518: HATPase_c" amino acids 308 to 415 (108 residues), 56.2 bits, see alignment E=2.2e-19

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 100% identity to bpy:Bphyt_0340)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1N6 at UniProt or InterPro

Protein Sequence (436 amino acids)

>BPHYT_RS01620 sensor histidine kinase (Burkholderia phytofirmans PsJN)
MQRITNTGRVNLGHLFWLRSLAIIGQLMTIAFVQIFIGVHLPLPAMLLVIALEVIFNAIT
WWRVSQQRPESNMELFGQIWVDLGALSALLFLSGGTTNPFVSLYLPSLAIAAAVLPWHLM
AWLAAFAVACYAVLGFDSVPLNLDNPANLFDYYRAGMWVNFMVSVGLIAWFVARMSRALR
LRDAALGDAQQRLLHDERAVALGVQAATVAHEIGTPLSTIAMLSEELRDAARSDKGLAPY
SADLELLEQQMTLCTSALARLRSRASITTNRQQVGEWLESFAEQWRLRHPHVKFERVGVP
PADVSLDDTVAVSQILTILLDNAARASRDHVTLSCALAARGDQIVFEVCDAGPGIPATLR
GSLGAMPVESTQGGHGVGLYLAFSAAARLNGSIELTDVSTIKPRGTRAVLKLPLAGRKFS
GKGRQGAAPSNTEKQA