Protein Info for BPHYT_RS01350 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 26 to 37 (12 residues), see Phobius details amino acids 45 to 72 (28 residues), see Phobius details amino acids 93 to 118 (26 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 278 to 288 (11 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 390 to 390 (1 residues), see Phobius details amino acids 395 to 414 (20 residues), see Phobius details PF07690: MFS_1" amino acids 31 to 243 (213 residues), 73.6 bits, see alignment E=7.5e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0287)

Predicted SEED Role

"MFS transporter family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0Z4 at UniProt or InterPro

Protein Sequence (420 amino acids)

>BPHYT_RS01350 MFS transporter permease (Burkholderia phytofirmans PsJN)
MSENNEVAATAVPAESPKNWLNRTVAGAGITSALGDFCYETTTVILPGFLAVLGVPAAML
GIIEGIADAVAAFTKMVSGYIADRLGHRKLLVLLGYGLTPVGQVLIALAAGWPLLLLGRI
VSWFGKGLRGPLRDAIVIQAVSPATRGRAFGFHRAADTIGAVLGPLLGVALLGWAKALPW
LGATGPFRLALWASVIPGVLAVLAFLTLVRDPERSSNPALRFFSSLRTLPRRFRRYLGAV
GIFGIGDFSHSLLILAATTLLTPRLGTIEAAQVAGLLYVWRNVVQVAVSYPVGVAADRTG
HLPVLVAGYVLGALTAALMALAFWWHIDSVPLLAGIFLVAGLYVAVQEALESTVTAEMVQ
PDTLAISYGALGTVNGTTKFVSSAIVGTVWTAATPMLGFALAAVLMIAGTIALARLERRA