Protein Info for BPHYT_RS00990 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 65 to 81 (17 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details amino acids 116 to 140 (25 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 324 to 343 (20 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details amino acids 390 to 410 (21 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 375 (346 residues), 81 bits, see alignment E=4.1e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0211)

Predicted SEED Role

"FIG00460211: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0S1 at UniProt or InterPro

Protein Sequence (420 amino acids)

>BPHYT_RS00990 MFS transporter (Burkholderia phytofirmans PsJN)
MSTAHRTPTPTTVKSSNSTDRAESLATWALALAQLVSWGSVYYSFSLLVVPMEQTMGWSR
TSTNAALSLGLLVSGFVAYPVGKWIDHGLGRRIMAIGSLIAAAMLLMWSATSSLTILFVA
WIGLGLSMAATFYDPLFAVLTHRYPLRYKTKITLVTLVAGFASTVFIPVTQFLVDLAGWR
LALVALAACNLIICLPIHVFAIRSSRIDPNAAQPSAERTAVDAAATRRALRTPTFWALAL
CFTTYYATFAALTFHLVPLMVERGVTNTVLDITMALIGPAQVIARAVWFAFDRKVTITTV
GFIVVTLFPVSTVVLIVAGKSAALLWIFALCYGAANGMMTILRGTIVQQFLWTEGYGAIS
GMLSFPSNIAKGIAPIAAASIWGLTDGYVAVEWTVLLVSALSAVSFFIAAKCASARPSYR