Protein Info for BPHYT_RS00895 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 175 to 192 (18 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 411 to 430 (20 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 395 (366 residues), 135 bits, see alignment E=3.2e-43 PF00083: Sugar_tr" amino acids 60 to 444 (385 residues), 150.4 bits, see alignment E=7.7e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0190)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0Q4 at UniProt or InterPro

Protein Sequence (460 amino acids)

>BPHYT_RS00895 MFS transporter (Burkholderia phytofirmans PsJN)
MSDSVYAAPRLDRLPLSGFHWRLFLLIGGGLFLDAFDVYLGGVVTGSLLKTGWSTLEMNA
WFTTMTFAGLTVGAWSAGELGDRFGRRFSYQVNLIIFGGASLAATLAPNMYWLIALRFIM
GIGMGAEIVISYGMLSEFVPPRYRGRLLAALSLFANSAVLIASLTSLWIIPNFGWRYMFA
IVGVAAIVIWLLRKKMPESPRWLVSQGRYAEAEAVLQSIEADISRNHELDDFVREQPVKP
QHVPIGVLFRSPVVWRTLVGSLIMVTIGYSVYGLINWLPSFFVRQGFDIVKSLSYSTVMS
LGAPAGTIIGIFLADRVGRRPAIIGAALVTAAMGLFYQHAASNTMLLVAGLCLICGIYVL
VAVGQGAYVPELFATSYRLRGSGVCGTAGRAASALCQFFVLWLFTMGGVNMVVASVVAIQ
VLLAVAVWALRIETSGVGLDHMPDDLEHTAGQPRIADIGH