Protein Info for BPHYT_RS00790 in Burkholderia phytofirmans PsJN

Annotation: conjugal transfer protein TraF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR02791: P-type DNA transfer protein VirB5" amino acids 11 to 213 (203 residues), 139.5 bits, see alignment E=7e-45 PF07996: T4SS" amino acids 30 to 211 (182 residues), 199.6 bits, see alignment E=3.2e-63

Best Hits

Swiss-Prot: 36% identical to VIRB5_BRUA2: Type IV secretion system protein virB5 (virB5) from Brucella abortus (strain 2308)

KEGG orthology group: K03200, type IV secretion system protein VirB5 (inferred from 100% identity to bpy:Bphyt_0165)

MetaCyc: 36% identical to P-type DNA transfer protein VirB5 (Brucella abortus 2308)
TRANS-RXN-477 [EC: 7.4.2.8]

Predicted SEED Role

"Minor pilin of type IV secretion complex (VirB5)" in subsystem Type 4 secretion and conjugative transfer

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T043 at UniProt or InterPro

Protein Sequence (236 amino acids)

>BPHYT_RS00790 conjugal transfer protein TraF (Burkholderia phytofirmans PsJN)
MIRSIVQTGIVPVAAVVMIVGTMPSARAQGIPVYDAQNVLQAIATVGQLKQEVQQELQLY
QSLSGTRGFGELMSNPVLSNSLPSNWQSVYTSIQSGGYAGLTGSAQTLRSASEIYNCEDQ
SGIDQQVCQRALNKPFQDKAFGTQAYQTELQELDQIQGLMQQIDVTQDQKGIAELQARIQ
TESTAVGNEMTKLQLFRMLADTEDRLIGEQQQELVLKRAGNTARLQDQMVPAGFGN