Protein Info for BPHYT_RS00380 in Burkholderia phytofirmans PsJN
Annotation: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 54% identical to UBIX_ECOLI: Flavin prenyltransferase UbiX (ubiX) from Escherichia coli (strain K12)
KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0077)MetaCyc: 54% identical to 2,5-furan-dicarboxylic acid decarboxylase 2 (Cupriavidus basilensis)
RXN-13093
Predicted SEED Role
"3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)
MetaCyc Pathways
- superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
- ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)
- superpathway of chorismate metabolism (42/59 steps found)
- 5-hydroxymethylfurfural degradation (5/10 steps found)
KEGG Metabolic Maps
- 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
- 1- and 2-Methylnaphthalene degradation
- 3-Chloroacrylic acid degradation
- Ascorbate and aldarate metabolism
- Benzoate degradation via hydroxylation
- Biphenyl degradation
- Fluorene degradation
- Phenylalanine metabolism
- Phenylpropanoid biosynthesis
- Purine metabolism
- Pyruvate metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 4.1.1.-
Use Curated BLAST to search for 4.1.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2SZE8 at UniProt or InterPro
Protein Sequence (197 amino acids)
>BPHYT_RS00380 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (Burkholderia phytofirmans PsJN) MTGIVQKKRVVVAITGATGAVYGVRLLEMLRHCTVTTHLIVSRAGWMTLLDETGLERNAL RDAASVYYDQNEVGASIASGSFQHDGMVIAPCSMKTLAAVAHGFDDNLISRAASVTLKEN RRLVLLARETPLTLAHLRNMTLAAEMGATVMPPLPAFYAKPDSLDAMVDYTVMRVLDQLH VEPPAAMRRWQGLGAAY