Protein Info for BPHYT_RS00375 in Burkholderia phytofirmans PsJN

Annotation: sugar ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 270 to 287 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 15 to 279 (265 residues), 64.1 bits, see alignment E=5.8e-22

Best Hits

KEGG orthology group: K05832, putative ABC transport system permease protein (inferred from 100% identity to bpy:Bphyt_0076)

Predicted SEED Role

"ABC transporter substrate-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZE7 at UniProt or InterPro

Protein Sequence (306 amino acids)

>BPHYT_RS00375 sugar ABC transporter (Burkholderia phytofirmans PsJN)
MNLINGFIGLFPVGMMQGLTYALIALAIMIPFRIINFADMTAEGSFPFGACVCAKLLMMG
FNPVIGLLGGTLAGFAAGLLTAYIHEKAKINTLLCGILVLSMLYSVNIRVMGQPNSALFA
YASVFSWLPAAGGGYLSRILMLGATDTVIGAGVLWFLGTQHGMAMRAIGSSPSMAKAQGI
NVKVYTLVGLGLANLFAALGGALLAQNQGFADVNMGFGVLVNGLAALLLGEAIVGNRSML
RQVLAPVLGSIVYFQMISVVLVIGFQPSDLKLVTSLFVLGTLLTMAQRKKRGANRRKAAT
AKMQAG