Protein Info for BPHYT_RS00360 in Burkholderia phytofirmans PsJN

Annotation: protoporphyrinogen oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01266: DAO
  • amino acids 1 to 35 (35 residues), 32.1 bits, 2.4e-11
• PF00890: FAD_binding_2
  • amino acids 1 to 35 (35 residues), 27.6 bits, 4.5e-10
• PF13450: NAD_binding_8
  • amino acids 3 to 67 (65 residues), 52.6 bits, E=1.1e-17
• PF01593: Amino_oxidase
  • amino acids 8 to 439 (432 residues), 136.4 bits, E=4.6e-43

Best Hits

KEGG orthology group: K00231, protoporphyrinogen oxidase [EC: 1.3.3.4] (inferred from 100% identity to bpy:Bphyt_0073)

Predicted SEED Role

"probable oxidoreductase"

MetaCyc Pathways

• superpathway of heme b biosynthesis from glutamate (10/10 steps found)
• superpathway of heme b biosynthesis from glycine (7/8 steps found)
• heme b biosynthesis I (aerobic) (4/4 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis I (aerobic, light-dependent) (4/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis III (aerobic, light independent) (4/9 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.4

Sequence Analysis Tools

See B2SZE4 at UniProt or InterPro

Protein Sequence (451 amino acids)

>BPHYT_RS00360 protoporphyrinogen oxidase (Burkholderia phytofirmans PsJN)
VIVIGSGIAGLTAAYRLGQAGMHVTVLEAAETVGGRMGDRREGDIVFNSGARLVYPFGGA
FNRLVADLALGDALVPLRRLSARCVTTKGDHLIELMPTVRSLATPGLHLGERVAMVRHAL
RMRSQRDRVDPDWAISALDVDPEADRLNLADYIRREIGPNAMSYLVEPVFRATRSFNPDA
LSTLFYRTTVPHLIGEDTVHTLKGGMGQVCRTLAGLLDVRTGTRVTSVEHQRDGDELRLR
VTLANGDALTADHVVCAVQGSLARELIRTPQAIERQMLANVHYNALGVVHYGFAKSLPAQ
MQFASRDVGSRIATFQQTPAAPDQGRPLTQVYCQLAPEAVDEAIRRGCTGELDVLLREEL
RARIPDFDRQVVAVVNQWIPRMLPLFAPGYGGRLRAFWRWQEAPAQASGRPVVYCGDWTS
QALLTGACASGERAARIVLARSQVVSGRAQS