Protein Info for BPHYT_RS00345 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 49 to 72 (24 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 329 to 351 (23 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details amino acids 390 to 407 (18 residues), see Phobius details PF00083: Sugar_tr" amino acids 12 to 211 (200 residues), 85.5 bits, see alignment E=3.7e-28 PF07690: MFS_1" amino acids 20 to 369 (350 residues), 113.7 bits, see alignment E=9.1e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0070)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZE1 at UniProt or InterPro

Protein Sequence (408 amino acids)

>BPHYT_RS00345 MFS transporter (Burkholderia phytofirmans PsJN)
MSPKNSTTRAVLATVIGNALEWYDFIIYGFFALAISSHFFGGSPDETLLATYATFALSFI
VRPIGGILLGMLGDRVGRRFTMLLIMASMTMSMLLMVATPTYKAIGFVATLVVIVARLLQ
SVSAGGEFSSAATYLLESVPAERRGFFSGLYSAGTQIATILAALSGLFISYVLSDASRDS
WGWRIPFAVGLLIAPVGLYIRRHLPETEAFSKSQASRVKGGFKTLFERPGTLVLALLLAG
AINSGAYILLAYAPTYVVKVLDLPMYVSFSALLVSGGIGAIATPLFGALADRVGAYRQLL
VALFIMVVTVAPLYSWMNTEPTMTKLLLCSGFFSIIYAASVAVVPNVMAYLFPAELRAAG
MALTYNVSAAIFGGASLYFVTLLIGVFRTPLVPAFYVLTVFASTFLAV