Protein Info for BPHYT_RS00260 in Burkholderia phytofirmans PsJN

Annotation: amino acid ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 35 to 55 (21 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 5 to 252 (248 residues), 115.6 bits, see alignment E=1.1e-37

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to bpy:Bphyt_0053)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtB" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZC4 at UniProt or InterPro

Protein Sequence (278 amino acids)

>BPHYT_RS00260 amino acid ABC transporter (Burkholderia phytofirmans PsJN)
MIALVLDVLTTASILFVVASGLLLVFGVMKIINFAHGAVITLGGYAALACTGLGMNPWLG
LPLGALVGGVAGVVVESLAVRPLYARPLDAILATWGLGIVISQVVTLCFGRGVHFARSPL
TGTVNVLGTEYSLYRLSLVLVALALGGLLTLLLQGTRLGLETRSVIMNEDLARGLGINSG
LVRFVTFSLGSALAGIAGMVIAPLSSIDPNMGVPWQVNAFMLVMVSGYSLLTLAVSCLVL
GAAQVLISVYIDPILGGLTITVLAAVILRIRPEGFARV