Protein Info for BPHYT_RS00150 in Burkholderia phytofirmans PsJN

Annotation: DEAD/DEAH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 PF00270: DEAD" amino acids 33 to 196 (164 residues), 164.2 bits, see alignment E=4.8e-52 PF04851: ResIII" amino acids 48 to 194 (147 residues), 36.2 bits, see alignment E=1.2e-12 PF00271: Helicase_C" amino acids 241 to 341 (101 residues), 92.7 bits, see alignment E=3.5e-30 PF03880: DbpA" amino acids 392 to 462 (71 residues), 81.1 bits, see alignment E=9.7e-27

Best Hits

Swiss-Prot: 41% identical to CSHA_GEOKA: DEAD-box ATP-dependent RNA helicase CshA (cshA) from Geobacillus kaustophilus (strain HTA426)

KEGG orthology group: K05591, ATP-independent RNA helicase DbpA [EC: 3.6.4.13] (inferred from 100% identity to bpy:Bphyt_0030)

Predicted SEED Role

"ATP-dependent 23S rRNA helicase DbpA"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZA3 at UniProt or InterPro

Protein Sequence (467 amino acids)

>BPHYT_RS00150 DEAD/DEAH box helicase (Burkholderia phytofirmans PsJN)
MNSPTTAGAPFSQLPLPPATLANLTQLGYVEMTPIQAASLPIALAGHDLIAQAKTGSGKT
AAFSLALLARLDARNFAVQAMVLCPTRELADQVTQEIRRLARAEENIKVLTLCGGTPMRP
QTASLEHGAHIVVGTPGRIMDHLERGSLPLQSLNTLVLDEADRMLDMGFFDDIATVVKQC
PKERQTLLFSATYPEGIVKLSQQFLRNPKEVKLAERHDNTKIRQRFYEVTEDGRLHAVGL
LLNHYRPVSTLAFCNTKQQCRDLLDVLRAQGFHALALHGELDQRERDQVLIQFANRSCSV
LVATDVAARGLDIAQLEAVINVDVTPDPEVHVHRIGRTGRADQEGWALSLASMNEMGRVG
SLEQAQKREVEWHKLSELTAASNERLLPPMETLQILGGRKEKIRPGDVLGALTGEAGFAG
SQIGKINVTEMSTYVAVERSIAREALRKLSAGKVKGKKVKVRMMDDA