Protein Info for BBR_RS20865 in Bifidobacterium breve UCC2003

Annotation: glycogen phosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00343: Phosphorylase
  • amino acids 1 to 55 (55 residues), 62.8 bits, E=1e-21

Predicted SEED Role

"Glycogen phosphorylase (EC 2.4.1.1)" in subsystem Glycogen metabolism or Maltose and Maltodextrin Utilization (EC 2.4.1.1)

MetaCyc Pathways

• glycogen degradation I (7/8 steps found)
• sucrose biosynthesis II (6/8 steps found)
• starch degradation V (3/4 steps found)
• glycogen degradation II (4/6 steps found)
• starch degradation III (2/4 steps found)

KEGG Metabolic Maps

• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.1

Use Curated BLAST to search for 2.4.1.1

Protein Sequence (60 amino acids)

>BBR_RS20865 glycogen phosphorylase (Bifidobacterium breve UCC2003)
MTLADFTAYCEIQGEIEVLYRDPLEWNRKAVLNVANSGYFSSDRSMEDYLDRIWHTGPLA