Protein Info for BBR_RS20480 in Bifidobacterium breve UCC2003

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 12 to 26 (15 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 231 to 256 (26 residues), see Phobius details TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 50 to 268 (219 residues), 179.4 bits, see alignment E=4e-57 PF02096: 60KD_IMP" amino acids 51 to 268 (218 residues), 158.3 bits, see alignment E=8.8e-51

Best Hits

Swiss-Prot: 92% identical to YIDC_BIFLO: Membrane protein insertase YidC (yidC) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K03217, preprotein translocase subunit YidC (inferred from 94% identity to bll:BLJ_2042)

Predicted SEED Role

"Inner membrane protein translocase component YidC, long form"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>BBR_RS20480 membrane protein (Bifidobacterium breve UCC2003)
MINQNQFLLDSGFWGFLYKILTPVEWLQTWIMKIVHDFFVMLGMSPVGVSWILAIIILVL
VVQACIFPLFYKQIKSMRKMQALAPKMQRIQNKYKGKTDQASKEAMSRETMKLYQDNNVN
PAGSCLPMLIQGPVFMSMFYTLSAIPYIANGKRDPLGAFDVATAKQFTQTDVFGIVSVTD
NFTRAATAGKVVIGVFVFLMCFCLWLMQYINMKRNMAAASMNKQTETMQKAMLWLFPVMY
IFSGASFPFAVLVYWLTNNVCNLCRTLWQVYCFPTPGSPAAEDKEKRDHRNENARREKAG
LPSLEEEALAKAKEEAARKANQGFQRQQPVRKRRKK