Protein Info for BBR_RS20345 in Bifidobacterium breve UCC2003

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 41 to 58 (18 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 200 to 217 (18 residues), see Phobius details PF14501: HATPase_c_5" amino acids 333 to 439 (107 residues), 102.9 bits, see alignment E=4.2e-34

Best Hits

KEGG orthology group: None (inferred from 45% identity to ske:Sked_02250)

Predicted SEED Role

"two-component sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>BBR_RS20345 ATP-binding protein (Bifidobacterium breve UCC2003)
MGTTITNALPDIPRIYTAICEWLACVTYLLVICRRVPWQRTVAVGAVGLLAMIGIQYFNG
AMPIWFWVIGMLLAFAGMWAIIWLGAGTGKREGVYIAARAFVLAELVASLHWQLVMFLDS
GDGIREARLMASVMLAIVYAACFAIAWLIERGNFASDAPTTTTAQLSIGTAAITIVTFAM
SNLSFISTNTPFSGTVGQEVFYIRTLVDFCGFAILYAQQEQARRMAASAELASINAQLES
QHQEYLASKENIESIGRLAHDLKHQIAALRAEVDPEHAAAGFEQLEASVAKASAQQHSGN
PVLDVILTTKMRTCADRGITLTAVADGKLLDGMSSMDIASLFGNALDNAIEATSKLPDKQ
QRLIRLALYGQGQFTVIRVENYYDSALKKDSTGALRTTKRDSSRHGFGVKSIRHIAAQYG
GEVTIRTEDHWFVLTVLLPR