Protein Info for BBR_RS20320 in Bifidobacterium breve UCC2003

Annotation: PTS ascorbate transporter subunit IIC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 124 to 155 (32 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 260 to 285 (26 residues), see Phobius details amino acids 306 to 329 (24 residues), see Phobius details amino acids 333 to 358 (26 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details amino acids 426 to 445 (20 residues), see Phobius details PF03611: EIIC-GAT" amino acids 10 to 409 (400 residues), 435.4 bits, see alignment E=1e-134

Best Hits

KEGG orthology group: K03475, PTS system, ascorbate-specific IIC component (inferred from 73% identity to gva:HMPREF0424_0633)

Predicted SEED Role

"FIG00732228: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>BBR_RS20320 PTS ascorbate transporter subunit IIC (Bifidobacterium breve UCC2003)
MNGVLSVLLDIFRQPSIIVALISLVGLAVQRKKATDIMKGTIRTMVGFLVLAAGASVVSG
ALDPFGSMFQHAFNVQGVVPNNEAIVGTVLVKYGSEAALIFFFGMIVNILLSMTSRFKYI
YLSGHVAFYMATMVAVILEVAGMSTWGVILWGSIAQGLIVTISPALVQPFMKDAAGTNDV
ALGHTGGAGIALGGLVARLTRSKKHPSKSTEDIKFPAGLGFLRDTTVIIALSMAVIYVVV
ALFAGSSYIESELSDGQNFIVFAILQAATFSAGVFVILAGVRVVLGEIVPAFKGISEKLV
KNSKPALDVPMIFTFAPNAVLIGFISSFVGGVVGMGIMALAGSTIIIPGIVAHFMTGGAT
GVIGNGQGGVRGAVIGSFVNGLAITFLPLFLLPVLGDTGMANATYSDADYGVAGILLGQF
GKGGQIGLIIGIIASVVVFYAASFAMSAREKKKAAVEAK