Protein Info for BBR_RS20300 in Bifidobacterium breve UCC2003

Annotation: isopeptide-forming domain-containing fimbrial protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 504 to 527 (24 residues), see Phobius details TIGR04226: fimbrial isopeptide formation D2 domain" amino acids 194 to 330 (137 residues), 107.1 bits, see alignment E=1.1e-34 PF16569: GramPos_pilinBB" amino acids 215 to 333 (119 residues), 103.5 bits, see alignment E=1.3e-33 PF17802: SpaA" amino acids 368 to 458 (91 residues), 57.4 bits, see alignment E=1.2e-19 TIGR01167: LPXTG cell wall anchor domain" amino acids 500 to 531 (32 residues), 20.3 bits, see alignment (E = 6.9e-08)

Best Hits

KEGG orthology group: None (inferred from 96% identity to bbi:BBIF_1761)

Predicted SEED Role

"Cell wall surface anchor family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (532 amino acids)

>BBR_RS20300 isopeptide-forming domain-containing fimbrial protein (Bifidobacterium breve UCC2003)
MKSLMKKVFAAAAAIATVFGLAATTVATANAADNATLTVSTTDAKFAGKTVNAYKMFSAT
VSGDGKAVSYTLTDEWKPFFKDSTASGLTDVTDANVNDKANGYVSKLTGKDLAAFATKAS
NWAQAKTNNIKAAATATVSTGATNGNYTATFNGLDYGYYVVAVPGATLANASGQYATLVS
VDRTNVTANIKGDLPTVDKKVQVDGTGKDATDAKIGDSLTFTLTSTIPDMSAYDTYTFNF
KDTLSKGLTFERVTSVTVDGVAAPLTVGTDYTVTTPTASNNTLTVAMNDFKNKQQANAGK
KITVTYTATLNENAVVGGAGNTNSAKIQYSNDPSTNGTGESEPSKVRVFTYGFTVDKYTG
DKYDNAATRLAGAEFTLALKNGTAISFVQVAAGNETTNAVYRVAKAGETGTTTTITTPAN
GKVDFRGLKNGEYTLTETKAPAGYNKLASAIGVEVNGKNDGTEAMGATVIIKYNNNNGSV
YDQTASNGIIPVQNKSGAILPGTGGMGTIAFTVIGVLVIALGVAWTLKRKNA