Protein Info for BBR_RS20280 in Bifidobacterium breve UCC2003

Annotation: galactose-1-phosphate uridylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 PF01087: GalP_UDP_transf" amino acids 36 to 235 (200 residues), 38.4 bits, see alignment E=1.8e-13 PF02744: GalP_UDP_tr_C" amino acids 251 to 429 (179 residues), 34.7 bits, see alignment E=1.4e-12

Best Hits

Swiss-Prot: 78% identical to GALT_BIFL2: Galactose-1-phosphate uridylyltransferase (galT) from Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b)

KEGG orthology group: K00965, UDPglucose--hexose-1-phosphate uridylyltransferase [EC: 2.7.7.12] (inferred from 77% identity to bbp:BBPR_1051)

Predicted SEED Role

"UDP-glucose hexose 1-phosphate uridylyltransferase" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.12

Use Curated BLAST to search for 2.7.7.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>BBR_RS20280 galactose-1-phosphate uridylyltransferase (Bifidobacterium breve UCC2003)
MSRNEATDNTVSSLNDVYASIDVLVDYAGKHLNLDPRDADWTRNRIFELFELDSYRPTGE
TTDDTAPDELLSRFRESCVAAGLFEPEEGPRYADVVMGLLSASPSAVQDRFVAVEQSNDG
MEAMRWFYDYSVANNYVKKAVLDKNPRFDSHGVTVTINLAKPEFKNMKKAAAGNSVAGGY
PSCTICHENEGFAGRDKRTLRTVPVTLGGEPWFWQFSPYGYFHQHGICVNTEHTPMHVDR
DTFGHLLDFVDRFPGYFLGCNAALPRIGGSVLAHDHYQGGGEHLPMHKAAAWATFHMNGY
PDAVVEILDWPGTAVRVVSRNRDAIVEISDMIRLAWQQFDDSAANIASHDADGNRQSAVS
PSAIITDRGYEMSLIFRNNAVSSEYPEGVFHAHPEFWPIKQEPIGLIEAQGLFILPGRLV
DQLAQLENALAEGQPLPASVSEFTLEWDELTAALNGNRDRAAIHQAVHEELGSVCERILG
NTAVFKTKEQTVAFLAELGLTRQ