Protein Info for BBR_RS20265 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 7 to 33 (27 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 302 to 327 (26 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 366 to 384 (19 residues), see Phobius details PF05977: MFS_3" amino acids 11 to 391 (381 residues), 37.7 bits, see alignment E=1.4e-13 PF07690: MFS_1" amino acids 12 to 244 (233 residues), 115 bits, see alignment E=5.8e-37 amino acids 219 to 380 (162 residues), 60.9 bits, see alignment E=1.5e-20 PF00083: Sugar_tr" amino acids 43 to 180 (138 residues), 35.6 bits, see alignment E=8e-13

Best Hits

KEGG orthology group: None (inferred from 99% identity to bln:Blon_2472)

Predicted SEED Role

"conserved hypothetical transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>BBR_RS20265 MFS transporter (Bifidobacterium breve UCC2003)
MIFGLSLLYWGLWLAILILWMGRFVTSFLSIYLVSALHLGEGVVGAVVAMYGFGAIIGCL
FGGALSDRFGRQSMIIIGEIGAAAALLVVSVLADPVALGAALFVYGAFASLPSPAIAAYI
ADVVPPKRQQRAYVLQSWAINFGYAIGPIVANQLIKISYSLMFYVEAAVMIAVTILLIVF
FREVRHLTTSAPAARPEGAMSRNWRRVLTDTPFLGFSLLMFGYFLVYFQSTSGLPIAMTD
LGLGLGDYSVLLTINGGMLCLLQIPAMKLFARMGNSRVLVMGLAVTAIGYAVQAVAHSWG
GFALAVVLWTLGELGTFPIATTTVAAMAPATARGTYQGVYNVVWSVSIALAPLIGGWVIG
GFGGRMLWIACTVVLVGVTVGLRVTKGSRDAAMAAAMGAEDDSQ