Protein Info for BBR_RS20260 in Bifidobacterium breve UCC2003

Annotation: PTS N-acetylglucosamine transporter subunit IIABC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 70 (27 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 120 to 136 (17 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 295 to 312 (18 residues), see Phobius details amino acids 317 to 341 (25 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details TIGR01998: PTS system, N-acetylglucosamine-specific IIBC component" amino acids 1 to 507 (507 residues), 585.4 bits, see alignment E=8.7e-180 PF02378: PTS_EIIC" amino acids 10 to 334 (325 residues), 222.2 bits, see alignment E=9.5e-70 TIGR00826: PTS system, glucose-like IIB component" amino acids 394 to 496 (103 residues), 52.5 bits, see alignment E=4.7e-18 PF00367: PTS_EIIB" amino acids 440 to 472 (33 residues), 50.3 bits, see alignment (E = 1.3e-17)

Best Hits

KEGG orthology group: K02803, PTS system, N-acetylglucosamine-specific IIB component [EC: 2.7.1.69] K02804, PTS system, N-acetylglucosamine-specific IIC component (inferred from 100% identity to bln:Blon_2471)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>BBR_RS20260 PTS N-acetylglucosamine transporter subunit IIABC (Bifidobacterium breve UCC2003)
MKAYIQRLGRALMLPVACLPAAALFLGIGYWIDPSGWGGGNVIAAYLCKTGSAILDNLGL
LFAVGVAVGMARDKDGASALSGLVGFMTITTIMGSASMFLGFDAENPPAAFAPGAIGNKN
VFFGIMVGCVSGALYNRFSKTKLPDFLAFFSGRRCVPILTAALMSVISLVLLFVWPLVYN
GLVAFGESLMGMGAVGAGIYAFFNRLLIPTGLHHALNNVFWFNLAGIDDITKFWNGVGGL
NGTTKAVLATGGFQPWGEYVTGMYQAGFFPIMMFGLPAGAFAIYRCAKPENRRTVGSLML
AGGLAAFLTGVTEPLEFSFMFAAFPLYVVHALLTALSVFIAASFQWIAGFNFSAGFIDWF
LSLRVPQAHMPWMLIVQGLVFAVIYYFVFTFMIKKFDLKTPGRGDGVDDEGAAAVAGILD
TGAAPAAAVSRDKYAALAAKLYALLGGKANIVDIENCVTRLRLGVKDTAKVDVDAIRKLV
PGVKVIDDRNVQVVVGTQVQAVADAMEELHKA