Protein Info for BBR_RS20235 in Bifidobacterium breve UCC2003

Annotation: dCTP deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 3 to 181 (179 residues), 209.7 bits, E=1.3e-66
• PF06559: DCD
  • amino acids 3 to 111 (109 residues), 24.8 bits, E=9.1e-10
  • amino acids 63 to 175 (113 residues), 32.9 bits, E=3.2e-12
• PF00692: dUTPase
  • amino acids 68 to 175 (108 residues), 35.1 bits, E=1e-12

Best Hits

Swiss-Prot: 98% identical to DCDB_BIFLD: dCTP deaminase, dUMP-forming (dcd) from Bifidobacterium longum (strain DJO10A)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 97% identity to bll:BLJ_2008)

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

• pyrimidine deoxyribonucleotides de novo biosynthesis II (4/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (9/14 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Protein Sequence (193 amino acids)

>BBR_RS20235 dCTP deaminase (Bifidobacterium breve UCC2003)
MLLSDRDILAAQSAGHISLDPWTPEMVQPASIDVRLDRYFRLFNNHAYTYVDPAENQGAL
TEQFEVAPDEPWILHPGEFALGSTWEYVKLNPTIAARLEGKSSLGRLGILTHSTAGFIDP
GFEGHITLELSNVSTLPVKLWPGMKIGQMCFFQLSSPAEHPYGSQGTGSHYQGQRGPTPS
RSYENFYRAHIKD