Protein Info for BBR_RS20220 in Bifidobacterium breve UCC2003

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 19 to 50 (32 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 144 to 172 (29 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 245 to 262 (18 residues), see Phobius details PF01925: TauE" amino acids 22 to 256 (235 residues), 148.6 bits, see alignment E=1.2e-47

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 87% identity to blo:BL1515)

Predicted SEED Role

"Protein of unknown function DUF81" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>BBR_RS20220 sulfite exporter TauE/SafE family protein (Bifidobacterium breve UCC2003)
MSEVSAEENHVDESPRGIAVMVVVGVLVGLLSGLFGIGGGTIIVPALVWLGLTQRHAAAT
SMLAIIPTSVSGVLSYAVNGNVDWIAALLVFIGMFVGGQIGSLLLSRLSEVVLRWAFVVF
MAFVILSQLIFVPSRDSSIELNLVTGLLMVVFGVIAGILASLLGVGGGAILVPSLSILFD
ASDLIARGTSLLAMFPNAVTTTVANVRRRMVHAKVGLIIGIVAALTAPLGTWIAEAMTPR
TGEILFATYLTVLLIRSVWVALKITRK