Protein Info for BBR_RS20165 in Bifidobacterium breve UCC2003

Annotation: Solute-binding protein of ABC transporter system for sugars

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01547: SBP_bac_1
  • amino acids 65 to 355 (291 residues), 100.2 bits, E=1.2e-32

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 99% identity to blj:BLD_1490)

Predicted SEED Role

"Multiple sugar ABC transporter, substrate-binding protein" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization

Protein Sequence (442 amino acids)

>BBR_RS20165 Solute-binding protein of ABC transporter system for sugars (Bifidobacterium breve UCC2003)
MNRIMRNSGAVLAAIFIAGSLTACGPGSASSSRSDTNPTDVSTDLGNKKYELTLWDGAGL
KTVDEALIAGFEAKYPNITIKGQYDPDNVSGQNGPRVISAKDAPDIARVTDMNSAVRGNH
LVSLEAYVDAYGWDVPDSQTELYRVDSNGKLGSGDLYALPNSYSVTGIYFNTKLAEQLGI
DAAPTSVEEFEADMQTAKDAGILPMMTYAKDGGTSFVFQALMANNSSAEDVQNWILQKSG
TFDNQAAQDAASTLQDWNNKGYMPEGVNAVDASTALSRFCNGEGLFFPSGNWNLDTVAKA
LGDDVQFFAFPGATSEDEPNVAANAGAFYGIPVNAKNRDAAAAFLDYTQSAEAQQIIVDN
SGYLPKSSTLDLKANSALQQSMFDAYADVLTSGHTSDFINNATAGMQSSGLIPNFQLLLD
NSITPQEFTKNVQAQYDKEAKR