Protein Info for BBR_RS20155 in Bifidobacterium breve UCC2003

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 23 to 24 (2 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 79 to 276 (198 residues), 53 bits, see alignment E=1.9e-18

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to blm:BLLJ_1875)

Predicted SEED Role

"Multiple sugar ABC transporter, membrane-spanning permease protein MsmF" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>BBR_RS20155 sugar ABC transporter permease (Bifidobacterium breve UCC2003)
MSLGLVSLLFLAPALVFYIAFELWPIIQTIWYSFYEWNGIDASTFIGVENYITVFTDPDL
YGSILHSFYLIIFFSIIPIVLGLIIAVLIKDMKSKVGRSFAQVCLFLPRVIPGAAAGVAW
TWMLADKGTANQLLRAVGLGDFAHVWLGDQSTSLNAVGVIGFWLQLGFCVVLLLSGIGGI
DQSLYEAASLDGAGWWRQLFSITLPGLRGQIGVCLTMTIISALASFDVVYMSTQGGPGTS
TMVPGVQVYRLAFTQQSVGLASALAVTLMILVLLVVGPLQRLVNGKEQ