Protein Info for BBR_RS20130 in Bifidobacterium breve UCC2003

Annotation: threonine ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00291: PALP
  • amino acids 29 to 302 (274 residues), 271.5 bits, E=4.6e-85
• TIGR01127: threonine ammonia-lyase
  • amino acids 32 to 416 (385 residues), 434.3 bits, E=2e-134

Best Hits

Swiss-Prot: 47% identical to TSAL_GEOSL: L-threonine ammonia-lyase (tdcB) from Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 96% identity to blm:BLLJ_1870)

Predicted SEED Role

"Threonine dehydratase, catabolic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis or Glycine and Serine Utilization or Threonine anaerobic catabolism gene cluster or Threonine degradation (EC 4.3.1.19)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-threonine degradation I (6/6 steps found)
• superpathway of L-threonine metabolism (13/18 steps found)
• L-methionine degradation II (2/3 steps found)
• L-threonine degradation V (1/2 steps found)
• hypoglycin biosynthesis (3/14 steps found)
• cyclosporin A biosynthesis (2/15 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.19

Protein Sequence (421 amino acids)

>BBR_RS20130 threonine ammonia-lyase (Bifidobacterium breve UCC2003)
MEQKDVLKALQRDHAAELKLASERLKGTARHTEIIPSPVLSEMTGHEILLKPENLQVTGS
FKIRGAYNKIASLAEEQLSHGIVTASAGNHAQGVAYAARERGAKATICMPQITPPLKVDA
TKAYGADVVLYGDVFDESAAHAAELAETKGMIYVPPFDDYEVICGQGTIGLEILEDVPNV
TDVVVPLGGGGLGAGVALAIKTFKPDVRVIGAIPEGSPAWKDSLASGHVSPADRVVTSAE
GVAVKHPGDLPFALLNEFLDDLVTVSERDINEMILLMLEKHKLVVEAAGAVSLAALEHLN
LRSRKFAAATGPHVVVPIMSGGNIDTVTIGAVIQKGMIARGRIMNFEVELPDTPGQLVKV
ATLLAEQRANVIQLDHDQFKASGHYTNAVSLGVTVETNGPDHIDRILAALREAGFSPKRI
Y