Protein Info for BBR_RS20100 in Bifidobacterium breve UCC2003

Annotation: YhgE/Pip domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 915 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 535 to 554 (20 residues), see Phobius details amino acids 574 to 597 (24 residues), see Phobius details amino acids 603 to 626 (24 residues), see Phobius details amino acids 633 to 652 (20 residues), see Phobius details amino acids 694 to 712 (19 residues), see Phobius details amino acids 771 to 794 (24 residues), see Phobius details amino acids 800 to 820 (21 residues), see Phobius details TIGR03061: YhgE/Pip N-terminal domain" amino acids 11 to 174 (164 residues), 138.4 bits, see alignment E=1.7e-44 PF12698: ABC2_membrane_3" amino acids 30 to 188 (159 residues), 39.5 bits, see alignment E=4e-14 amino acids 525 to 701 (177 residues), 39 bits, see alignment E=5.5e-14 TIGR03062: YhgE/Pip C-terminal domain" amino acids 510 to 709 (200 residues), 152.2 bits, see alignment E=1.5e-48 PF01061: ABC2_membrane" amino acids 565 to 677 (113 residues), 27.7 bits, see alignment E=1.9e-10

Best Hits

KEGG orthology group: K01421, putative membrane protein (inferred from 80% identity to blb:BBMN68_1434)

Predicted SEED Role

"Phage infection protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (915 amino acids)

>BBR_RS20100 YhgE/Pip domain-containing protein (Bifidobacterium breve UCC2003)
MRTVWQVFLRDCKRILRNPVAAVVTLGVAVLPSLYAWFNILANWDPYSATGNLQVAVANE
DRGTTNDLVGHLNAGKQVVIKLKHNDQLGWRFVSNEEQAVQGVQTGDYYAAIVLPKDFSA
SLVDSLTGTSKQPKIKYYVNEKKNAIAPKITDTGATTIDEQINSTFVTTVSNTVAAAISQ
AGDDLDQATNSTQNNVVADLGSVLSTIATVQDALTDLRTTLDQSDTALADARSTTASLQR
SITAAQQASQQSGALLAETQDGSQVFAASLVSALDTSSAQLSGLTVNVNNAAGTINQSFN
TAQNSVDTITNALNSPLDKTATSLDTLKDALNKAGISADTTDPTGKRIWDHINAIDDAIS
TQQAKINTFHEDTTRFIDSGKSATTNLSGAMSGTATGGIAALNTARSSLTGTVMPSLTSS
LNSFAALNGTLNGTLTSLSGTLDQTNGLFDQLSSTIAQTRTTIGSAQDSLNQIIDDVSTV
RTDVATLDSSAVYQKIRDTMHLDDKGFGEFMGSPVTLTTKVVYAIDNYGSAVTPFYTNLA
LWVGGFVLIAIYKLEVDRESIRRINAKQAYLGRWMLLVTIGFLQAIIATVGDLVLGIQCE
HPLLFILAGIFCSFIYINIIYALAVAFRHIGKAIAVILVIVQIPGASGLYPIEMMPDFFR
KLHPWLPFTYGINAMRGPIAGTYSNHYWLDMLHLFWYLPAALFVGLVVRRYAMNLNALFD
RRLGDTDLMITEHNSMVNEQVSLASVFRTVSDSKELKAIITRRAHRFFARYPMMIVAGLA
LLTILPFVFLILLFVTQEKIAMLTSWILSIILIDAYLIVVEYTRESYAMQLGVSAMNADE
FRDVMLNGYVWRRFRSHGRHEAASAESAVDTDPDIGEVTEQLTPFERTGSTDSSDSSKSS
ESTITDTNPAQGGAR