Protein Info for BBR_RS20095 in Bifidobacterium breve UCC2003

Annotation: NADPH-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00881: Nitroreductase
  • amino acids 11 to 169 (159 residues), 55.2 bits, E=5.2e-19

Best Hits

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 85% identity to bll:BLJ_1980)

Predicted SEED Role

"Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Protein Sequence (255 amino acids)

>BBR_RS20095 NADPH-dependent oxidoreductase (Bifidobacterium breve UCC2003)
MATNATIETLLNRRSIRKFKDEPIDDDATATLETVAQHAASSQFLNDWSAIRVSDPAIKA
RLAEIGNQPYIATAPLLYVFVIDEHRNAHIAQRKGIDPTSDEFHLKYSYRFTQAQNDAVL
ALHAMETAAYSLGLGGVILGSLLNDIPALIDLLNLPEYTYPVLGLALGKPDQEPTLKPRM
PRSMQFFDNTYPADDDGMLEQLPDFDNKVHQYYDLRQTDRPVDAFSDQIASVSRQGVSGK
TLLDKAAAQGFQLDK