Protein Info for BBR_RS20085 in Bifidobacterium breve UCC2003

Annotation: histidine phosphatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00300: His_Phos_1
  • amino acids 22 to 236 (215 residues), 143 bits, E=4.6e-46

Best Hits

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 85% identity to blj:BLD_1504)

Predicted SEED Role

"putative phosphoglycerate mutase family protein"

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1

Protein Sequence (237 amino acids)

>BBR_RS20085 histidine phosphatase family protein (Bifidobacterium breve UCC2003)
MSEQHMDGTVAVDASCGKAGFLVLLRHGQTFWSESGQHTGRTNIPLTEVGRQQAMDAGAR
LREAFPEGFDPECVFSSPLKRACQTAELAGFAQHGILDGIAEWDYGRAEGRTRQQVSEAS
GFSWDVWRDGPRSLTPTLEGDWVDTLPDGEQVNVHSGAGETLDEVAARARAAIEEVTPLL
QSGRNVLLVAHAHILRILTSQWLNVDPQFARLLRLDTAHYSVLSVYKGDNVIERWNA