Protein Info for BBR_RS20065 in Bifidobacterium breve UCC2003

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 74 to 100 (27 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 92 to 272 (181 residues), 64.4 bits, see alignment E=5.9e-22

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 98% identity to blm:BLLJ_1856)

Predicted SEED Role

"COG0395: ABC-type sugar transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>BBR_RS20065 carbohydrate ABC transporter permease (Bifidobacterium breve UCC2003)
MNENKPVKHGALWTVLFAVVSLFWIFPIVLVLINSFKQKAYISKNAFSLPAGKAFVGFEN
YVRGVETTQFFASFGWTLLITVGSVILILVCTSMCAWWIVRVNNWAAKLLYTLFLFNMIV
PFQMVMFTLSKIADMLKLNTPWGLCIVYLGFGAGLAVFIFTGVIKGIPAELEESAMIDGA
SVPRIFFQIVVPIMKPSIVSVAILEAMWIWNDYLLPYLTLDLGKYKTISVAVQYLKGGYG
SVDMGAMMACLVLAIIPIIVFYLVCQKYIVSGVMAGAVKG