Protein Info for BBR_RS20055 in Bifidobacterium breve UCC2003

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 31 to 48 (18 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 166 to 190 (25 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details amino acids 443 to 461 (19 residues), see Phobius details amino acids 467 to 485 (19 residues), see Phobius details PF00324: AA_permease" amino acids 30 to 485 (456 residues), 381.6 bits, see alignment E=5.6e-118 PF13520: AA_permease_2" amino acids 34 to 480 (447 residues), 140.2 bits, see alignment E=9.6e-45

Best Hits

Swiss-Prot: 44% identical to YIFK_ECOLI: Probable transport protein YifK (yifK) from Escherichia coli (strain K12)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 95% identity to blj:BLD_1513)

MetaCyc: 44% identical to threonine/serine:H+ symporter ThrP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-71; TRANS-RXN-72

Predicted SEED Role

"Aromatic amino acid transport protein AroP" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (490 amino acids)

>BBR_RS20055 amino acid permease (Bifidobacterium breve UCC2003)
MSTTDAPKKPRETDDVPVPATLRKSLKNRHIQLIALGGAIGTGLFYGSSESIALAGPSIL
LAYLIGGFAIFMIVRALSEMSVEDPKAGAFSYYATRYWSKRAGFISGWNYWFNYILVSMV
ELAVVGSFVNYWFPAIPTWVSAAVFLVLITAANLLGVSKFGEFEFWFAIIKIVAVIAMII
GGLAVIIFALPTASGIKASFANWFTVGGGFFPNGLMGHTDNGWTGLLMALVVVMFSFGGT
ELIGITAGETEDPKITIPRATNDIIWRILVFYIGALGVIMAVVPWNTIDGKSSPFVQIFD
SVGIHAAAGILNFVCLTAVMSVYNSGLYANSRMLYSLAKQGNAPAYLGKLNSKGVPVAGV
LTSAVITAIAVVVVFVWPEFAFNYLMSIATIAGIINWTMIMFTEMKFRKVVEAGGAPEDS
DLAGKSGQEALDAIHFKLPFAKVTPWVVLVFLALVVVLMCFSASYRIAVIAGVIWLAILF
VAYQITQAKK