Protein Info for BBR_RS20040 in Bifidobacterium breve UCC2003

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 transmembrane" amino acids 38 to 55 (18 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 115 to 140 (26 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 233 to 258 (26 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details amino acids 322 to 345 (24 residues), see Phobius details amino acids 378 to 398 (21 residues), see Phobius details amino acids 404 to 426 (23 residues), see Phobius details amino acids 447 to 467 (21 residues), see Phobius details amino acids 473 to 490 (18 residues), see Phobius details PF00324: AA_permease" amino acids 37 to 471 (435 residues), 278.8 bits, see alignment E=8.3e-87 PF13520: AA_permease_2" amino acids 39 to 472 (434 residues), 119.7 bits, see alignment E=1.6e-38

Best Hits

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 92% identity to bll:BLJ_1957)

Predicted SEED Role

"S-methylmethionine permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (507 amino acids)

>BBR_RS20040 amino acid permease (Bifidobacterium breve UCC2003)
MADTNANGNAQQSGSKLKSVESLDQTNAMERGLSNRHVQFIAIGGTIGTGLFLGSGKSIS
LTGPSIIFVYILVGVIMFFLMRAIGEMMYRDPSQHTFINFITRYLGNGWGHFAGWTYWAA
LVLLGMTEITAVSTYFITFFDTFGIDLTHWKWLIELCFLVSLVSVNLIAVKVFGEVEFWF
SMIKITLIGAMIVTAVVMIVIGYQYPAARIHGVDHVSPAGHAGLDNLFAGFSFAPNGCMA
FLMSFQMVFFAYELLEFVGVTVSETKNPREVLPKAVNEIIVRVLIFYVGALVAIMCIVPW
TSFKPNEDGSFASPFIMVFQYAGLNWASALVFFVVITAASSSLNSLLYSAGRHLYQLAEE
SPSPMLNKIGQVSDRKVPARAILVSAVLILLSPIVNAIPGVSGAFVLFSSASSAVFLFIY
ILTLVAHRKYRRSDDFIPDGFVMPVWKVLNTVAIAFFVFIYLTLFLADDTRNSAIAGLVW
LIGFGGFSLLRERYRSRDLKAALEHKE