Protein Info for BBR_RS19890 in Bifidobacterium breve UCC2003

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details amino acids 295 to 320 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 116 to 325 (210 residues), 115.6 bits, see alignment E=1.1e-37

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to bll:BLJ_1940)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>BBR_RS19890 ABC transporter permease (Bifidobacterium breve UCC2003)
MFKYIIKRIVNYVIMLFVAVSMTYFLASAFMDPRSNYMSRNPHPPIASINRSLDLANIND
QTPVVIRYFRWLKGILTQWNWGLSPDQSPVAPAIASRISASLQLVTLATVLSILFGVSIG
VYTAIRQYKWQDRVLNTTATFFLVVPAAVMGLMVVLLAINFNNIVGSRAFYVTGLHSYQG
SNPVLWVFDYLQHLILPTIVMTIPGMVGYHLTQRTYLLDTMNADYVRTARAKGLTLNAAI
RRHALRTSLIPTAVDVAFSIAGVFTGAVITENVFAINGLGMYFTQTIANNDINGAVAVAA
FGGVCTLSGALLADIFSAWLDPRIRLS