Protein Info for BBR_RS19885 in Bifidobacterium breve UCC2003

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 46 to 65 (20 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 212 to 242 (31 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details PF12911: OppC_N" amino acids 34 to 84 (51 residues), 45 bits, see alignment 7.8e-16 PF00528: BPD_transp_1" amino acids 127 to 307 (181 residues), 90.4 bits, see alignment E=1.2e-29

Best Hits

Swiss-Prot: 46% identical to Y1282_MYCTO: Putative peptide transport permease protein MT1319 (MT1319) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 99% identity to bll:BLJ_1939)

MetaCyc: 33% identical to glutathione ABC transporter membrane subunit GsiD (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>BBR_RS19885 ABC transporter permease (Bifidobacterium breve UCC2003)
MELTDPQGSEPQSADARNAQEASSADDFHRTGRMQLYVRRFMRRPSAVVGLVVLILLILL
AIFGSKFSQWSYDEPDFAALASPPSAQHWLGTTVGGSDMYAMIIRGLGRSLTIGIFSSFG
TTIIAALVGTAVAFFEGWFERVGMWLLDMLLVVPSFLLIALIVGMAAGGSDWLWLAIGLT
AFGWIGYARTLRTLTLSLRDREYIRAAKFMGVPSFTIIVRHLVPNLGSVLVINTVLGVIG
AVNSETSLSFLGLGIKAPDTSLGTLLNAGQSVVQTSPWVLIFPSVVLIVLTFSVQLIGDG
LRDAIDPYSRSGGKAE