Protein Info for BBR_RS19880 in Bifidobacterium breve UCC2003

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 712 PF00005: ABC_tran" amino acids 50 to 208 (159 residues), 104.2 bits, see alignment E=1.9e-33 amino acids 410 to 561 (152 residues), 115.4 bits, see alignment E=6.4e-37 PF13304: AAA_21" amino acids 177 to 243 (67 residues), 27.1 bits, see alignment E=8.3e-10 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 259 to 345 (87 residues), 74.2 bits, see alignment E=1.1e-24 amino acids 611 to 711 (101 residues), 72.7 bits, see alignment E=3.1e-24 PF08352: oligo_HPY" amino acids 259 to 324 (66 residues), 71 bits, see alignment E=1.7e-23 amino acids 613 to 676 (64 residues), 66.1 bits, see alignment E=5.6e-22

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 99% identity to bll:BLJ_1938)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (712 amino acids)

>BBR_RS19880 ABC transporter ATP-binding protein (Bifidobacterium breve UCC2003)
MSNEQRNERNANTTNPNTTGAQGMASEPVISVRDLTVSFASEAGTVHAVRGMNFDLYPGK
TLGIVGESGSGKSVTSMAIMGLLDKNASVKGSITYHGEELLNKSDFEMSEIRGKGIAMVF
QDPLSALTPVFSIGDQIKEALVTHNPKMTEQQIHDRSIELMNLVGIPDPEGRLKSFPHEF
SGGMRQRVMIAMAIANDPDVIIADEPTTALDVTIQAQVLEVLRKAQRETGAAVIFITHDL
GVIAGVADDIVVMYAGRPVEKADVDSIFDHPAMPYTMGLLGAVPRSDRERNSRLVPIPGS
PMNLVNMPKGCPFAPRCPLATDICHTTEPAMEPVPGRPGQFVACHRTQEIVSKGLTFHDV
YTVAEAAKSKFAGVPRDERKMVLDVKHMRKTFPLTAGGFLRRKIGEVKAVDDVTLDVREG
ETVALVGESGSGKSTTLMEIMAFKQPQDGEIEMFGTKLEHKMPREKRRELRSSVQYVFQD
PMSSLDPRLPIYDILAEPMKVQHYSKEQIRERIGELMRLVELNPDQVDRFPTQFSGGQRQ
RIAIARALSVNPQLVLLDEPVSALDVSIQAGVINLLEDLQNKLGVAYLFVAHNLSVVRHI
SSRVAVMYLGRIVESGATEDVFEHPLHPYTQALISAVPVPDPKAERTRQRIVLEGEVPSP
TETFEGCPFMGRCPLMPKLSAEQQARCRGERPALRPYDTSRPSGHQVACHFA