Protein Info for BBR_RS19805 in Bifidobacterium breve UCC2003

Annotation: glycosyl hydrolase family 25,lysozyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 619 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF01183: Glyco_hydro_25" amino acids 281 to 467 (187 residues), 90.6 bits, see alignment E=1.6e-29 PF18885: DUF5648" amino acids 491 to 528 (38 residues), 52 bits, see alignment 5.6e-18 amino acids 536 to 574 (39 residues), 58.2 bits, see alignment 6.6e-20 amino acids 582 to 618 (37 residues), 49.7 bits, see alignment 2.8e-17

Best Hits

Predicted SEED Role

"1,4-beta-N-acetylmuramidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (619 amino acids)

>BBR_RS19805 glycosyl hydrolase family 25,lysozyme (Bifidobacterium breve UCC2003)
MSAKRMMSAVAVLASMTLVSAVCAAPANALSGVSVDALANASTDSFKTQTVSDDTAADTM
PDNPDAALPDQVSAAIPDDATVVSEDHAVTADGELKNITTGETVTDPALVGTQDSQPDPL
AKTDGESFIPVQADEVKQKVAANGGDANAGAADAQTAPDTPDTQPEQPRPNDSSKYDQPS
QPDQSNQSDSPAPSDSGNAFNSGETFDSDEAANSGDVPDSGNTSDSSAATSGTAKATAEG
SVRLAALQNNEYGAHWGSYNGTAAFFDASNSLFVQQAKGVIDVSAWQGTIDWQAVKNSGV
EGAIIRIAYGWDNGFDNQALRNISECRRLGIPFGVYLYSYAYDANTGAAEGSSLVNLLQK
AGVSSSDLGYPVYYDLEKWTWAGHEVPNNPGTYNGIVNAWYSKLRSAGYTNLAVYSYTSY
LNKELNSSNIHSKTRWVAQYGSSMEYTAFPTNDRGWQYTSKGRVNGISGTVDLSAFGNKT
STAPVGATGSVYRLYHPGIRVHHYTADAHEMSVLVNQRGWVYEGIMFKTPTSGQPVYRLY
HPGIKQHVFTLSQHERNVLSKQRGWIYEGVAWYSNPNGGTAVYRLYNGSNYEHFYTSNRN
EYNIRGSQGWTKEGIAWRS