Protein Info for BBR_RS19795 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 696 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 62 to 87 (26 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 305 to 328 (24 residues), see Phobius details amino acids 380 to 399 (20 residues), see Phobius details amino acids 406 to 430 (25 residues), see Phobius details amino acids 440 to 461 (22 residues), see Phobius details amino acids 469 to 488 (20 residues), see Phobius details amino acids 494 to 515 (22 residues), see Phobius details amino acids 520 to 543 (24 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 98% identity to blf:BLIF_1877)

Predicted SEED Role

"FIG00423906: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (696 amino acids)

>BBR_RS19795 hypothetical protein (Bifidobacterium breve UCC2003)
MVMSAYPSIRERLFRLAPVASTESVPVLCIRFLLILMPLLVIGAMIAFGVKPVGMWMHRH
RFMLGASVIAACVLLNISGSSIGMWNYWLGHDMSTDVVWGTPRIIRTDEYVVGTPLAFSQ
SYSGYSYFNDLFGNKPADMFIVKDAPVLALAELFRPFHWGYILFGSSRGLAFYWSARLVV
LFLAAYEFFLCISNDRRQEKHKGVAFVGAILIACAPLVQWWFAVNALPEMLIAIFVSIVC
FDRYLGDTESGHRAAYAAVILICAGMFALTLYPAWQISLGYLLAVLILCIVIRHWGHIRI
SRKDALIFVGEIALFCVILGSAVVTSWGTIQSMLHTAYPGARQSIGGGLPPLSLISSVGT
LFFPFKDYVVDSVTTNMVEASRFVDLFPLGIILAVFGMIKRKKVDVLSAWLITVIALFSI
FACVGMPLWLSKIMMLTSVTSGRCVVVLGVANIAVLVRAAAIIDGKLSWKQSLLVTFVFA
AILAWANHAMYLSYIGRLLVVVCFAIAGLLSFAVLNNGVIARTVVAPIVSVGLLVSGLSV
NPVQYGSAPVTKQPLIQQVQSLQSENPGMWAIDDAFGSQLANLAVANGIHTLNALEVTPD
IATWKKLDPNGQWEEIYNRYAFVSVNVVEQESADVFTLVAPDSFTVHVTPEQLRKLGVSN
VLSPQKLDAMQFNGYSFERIGETIDGRTPYRIVQHQ