Protein Info for BBR_RS19750 in Bifidobacterium breve UCC2003

Annotation: LTA synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 764 transmembrane" amino acids 90 to 111 (22 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details PF00884: Sulfatase" amino acids 378 to 679 (302 residues), 138.1 bits, see alignment E=2e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to blj:BLD_1576)

Predicted SEED Role

"Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (764 amino acids)

>BBR_RS19750 LTA synthase family protein (Bifidobacterium breve UCC2003)
MGDTQDNQEFTVEEADTNGTTSAESSQSSAHSDRDDNSQEAQKSKPSLPPIFQQIRAQLN
TLMASQTMTALSKALTVLHSVFKKRPRFPYLLYIMVMAIVDSAAVLFIQWGTYTEPTYTA
PSTVDETTRLLNSIRGQLTRFVAQMWMEQKYIWLLNFCVLGMVYLVLIFVLNRFWVATAL
FAIITSVFAVANHIKIQLRNEPVIPSDLSFISSGNGGEVASFIPKDSQALVNNTITMLVW
LTIACLLLQFIDGRRCVISFHWRRPLRNTKTIIGNCTRIVAVIVSTSLLCSFTLNLNTVG
SWSHNWAQALGDSPTLWDAAGDASLNGPTINFLRLANPKTMTKPSDYSQATMQEIAQRYN
KIAEKTNQSRSNNLTDNTMIMILSESFSDPTRVPGITLSEDPMPDIRALKNTTTSGLMLS
PGYGGGTANIEYQALTGWDLALFDNSMQVPYQQLVPHQKVTETFNQLWNDRYGASGSIAF
HPYYKNMYLRDIDYKKFGFSHFYTLDSNPPITHHDGLDNSPYASDAEAYQNVVDELQNSN
HPQFIQLATMQNHPPYSDWYSDNQFKDADTTNLPADEKTGVDTYIKGVSITDQATTDFLN
QLDAIDQPITVIFYGDHLPGVYTTARASSKNTITMQETDYFIWSNEASASAGTKLDPAAA
ATSYTSPNYFMAMASDHMNTKVSAYIAFLSAMRAEIPATERLTLGVSGVTDNTPTVYLDA
NGNVVSKKELSSQQKKLLNDYRLIQYDMTAGKNYLSSTKFFDVK