Protein Info for BBR_RS19740 in Bifidobacterium breve UCC2003

Annotation: DUF2142 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 169 to 186 (18 residues), see Phobius details amino acids 195 to 195 (1 residues), see Phobius details amino acids 198 to 224 (27 residues), see Phobius details amino acids 232 to 249 (18 residues), see Phobius details amino acids 255 to 272 (18 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details amino acids 381 to 402 (22 residues), see Phobius details amino acids 420 to 438 (19 residues), see Phobius details PF09913: DUF2142" amino acids 29 to 429 (401 residues), 113.5 bits, see alignment E=5.3e-37

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>BBR_RS19740 DUF2142 domain-containing protein (Bifidobacterium breve UCC2003)
MKRVAHVLKGSSCNIAIFLVLFTLQACMFVVQVGPLTIPDPDMHPLSTYALATGQSLNPP
VKGKDKHGNAIKKQYLKGDDRLLMIPGAGNILVFDALERAWRGDSLQDGQRSADIMPASQ
IVVPNETRSNRSNAYFPLDYLPQAIGMKIAMLVNLSPYAQWQAARISNSILYAIMGCFAI
ALLPRWKSLMALLLVIPPVAFVASSLMIDGMIVALSACMVAAIATIAGNKHVISLPCTVA
LGVLAWALACEKLSYAFVAGAALFLPSAVMTVRRKVEFVGVAAVLMGVLYLPWSVLFSSS
LAQVNVSHNMSVALSHPILTIGKIVRSMIFLGTYHLTQLPVWYTVMSVVLVLVWLAALVY
TVKTTGAVRMAPSAWVGKYRFLILALVIAAAEIAAFVLFVGMTWNDLESMSRFGVFQGIQ
GRYVLPVLPVFLLGLVIVDDRKVSQRALAC