Protein Info for BBR_RS19705 in Bifidobacterium breve UCC2003

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 98 to 123 (26 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 254 to 271 (18 residues), see Phobius details amino acids 283 to 306 (24 residues), see Phobius details PF03547: Mem_trans" amino acids 8 to 135 (128 residues), 33.1 bits, see alignment E=1.2e-12

Best Hits

KEGG orthology group: None (inferred from 75% identity to bad:BAD_0937)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>BBR_RS19705 permease (Bifidobacterium breve UCC2003)
MIFQAGSLLLVIIGAYALKHVHIFDERDYRVVQGLVFNLTLPCAIILSFATNKHDMHMLW
IVLFGFFACAIPLFIVYIGSRGDEKNYRAFQMLNASGLNLGAFCLPVVQTFMGASAGLPI
IMLDIGNATVATAGSLTITRTLLHMDENFKSLPLILRLHNIARDFLSSISFDIYMLMLVF
MFLHITIPQPIVTLITPFANANAFCAMAMIGLMMEIPDNRKDKVELGKVIAWRMAFGATI
AVAAWFLLPFDMRIREIIVLGSFAPITIFSTKFTDSLTGNAKLAGFSLTVTAIISLVVMT
VLHALLPGA