Protein Info for BBR_RS19700 in Bifidobacterium breve UCC2003

Annotation: ATP-dependent chaperone ClpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 889 TIGR03346: ATP-dependent chaperone protein ClpB" amino acids 5 to 861 (857 residues), 1297.5 bits, see alignment E=0 PF02861: Clp_N" amino acids 18 to 64 (47 residues), 32.1 bits, see alignment 6.3e-11 amino acids 94 to 146 (53 residues), 45.6 bits, see alignment 3.8e-15 PF00004: AAA" amino acids 204 to 336 (133 residues), 49.9 bits, see alignment E=2.7e-16 amino acids 613 to 731 (119 residues), 33.8 bits, see alignment E=2.6e-11 PF17871: AAA_lid_9" amino acids 343 to 445 (103 residues), 122.4 bits, see alignment E=4.4e-39 PF00158: Sigma54_activat" amino acids 604 to 727 (124 residues), 28.3 bits, see alignment E=7.9e-10 PF07724: AAA_2" amino acids 607 to 769 (163 residues), 231.1 bits, see alignment E=4.7e-72 PF07728: AAA_5" amino acids 612 to 736 (125 residues), 52.8 bits, see alignment E=2.6e-17 PF10431: ClpB_D2-small" amino acids 775 to 855 (81 residues), 100 bits, see alignment E=3.8e-32

Best Hits

Swiss-Prot: 98% identical to CLPB_BIFLO: Chaperone protein ClpB (clpB) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K03695, ATP-dependent Clp protease ATP-binding subunit ClpB (inferred from 98% identity to blj:BLD_1585)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (889 amino acids)

>BBR_RS19700 ATP-dependent chaperone ClpB (Bifidobacterium breve UCC2003)
MEQKFTTMAQEAVGDAIQSASAAGNAQVETLHVMDALLRQENGVVRSLIEAAGGDPQAIG
AAVRNALVALPSASGSSTSQPQASRQLTAAIAQAEKEMQQMGDEYVSTEHLLIGIAASKP
NQSAEILEKNGVTAASLRKAVPGVRGGAKVTSPDAEGSYKALEKYSTDLTAAAKEGKLDP
VIGRDQEIRRVIQILSRRTKNNPVLIGEPGVGKTAVVEGLAQRIVAGDVPTTLQGKKLIS
LDLGSMVAGSKYRGEFEERLKSVLNEIKNADGQIITFIDEIHTIVGAGAAEGSMDAGNML
KPMLARGELRLIGATTLDEYRENIEKDPALERRFQQVFVGEPSVEDTIAILRGLKQRYEA
HHKVTIGDDALVAAATLSNRYISGRQLPDKAIDLVDEAAAHLRMELDSSPEEIDELQRKV
TRLEMEEMQLKKAEDPASKERLGKLQAELADTREKLSGLKARWDAEQAGHNKVGDLRAKL
DDLRVQADKFTREGNLAEASKILYGEIPAIQKELAAAESADAESADAGAENPADEPMVPD
RVDADSVAEIVSDWTGIPVGRLMQGENEKLLHMEDYLSKRVIGQKEAIATVSDAVRRSRA
GISDPNRPTGSFLFLGPTGVGKTELAKALADFLFDDEKAMVRIDMSEYMEKASVSRLIGA
APGYVGYEQGGQLTEAVRRRPYSVVLFDEVEKANPEIFDVLLQVLDDGRLTDGQGRTVDF
KNTILIMTSNLGSQFLVNEDMDADAKKRAVMDAVHMNFKPEFLNRLDDIVMFHPLTREEL
GGIVDIQVKGVAQRLTDRRITLDVTDSAREWLANTGYDPAYGARPLRRLVQTEVGDQLAR
MLLAGKVHDGDTVLVDQTGGEHLELSAWANDQIASDDPDVSVDNVSEDK