Protein Info for BBR_RS19680 in Bifidobacterium breve UCC2003

Annotation: uracil phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01091: uracil phosphoribosyltransferase
  • amino acids 3 to 211 (209 residues), 246 bits, E=1.5e-77
• PF14681: UPRTase
  • amino acids 5 to 210 (206 residues), 211.8 bits, E=7.9e-67
• PF00156: Pribosyltran
  • amino acids 70 to 176 (107 residues), 51.8 bits, E=6.1e-18

Best Hits

Swiss-Prot: 99% identical to UPP_BIFLD: Uracil phosphoribosyltransferase (upp) from Bifidobacterium longum (strain DJO10A)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 99% identity to bln:Blon_2363)

MetaCyc: 37% identical to uracil phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Uracil phosphoribosyltransferase. [EC: 2.4.2.9]

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

• pyrimidine nucleobases salvage II (2/2 steps found)
• pyrimidine nucleobases salvage I (1/1 steps found)
• superpathway of pyrimidine nucleobases salvage (3/4 steps found)
• superpathway of pyrimidine ribonucleosides salvage (6/10 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.9

Protein Sequence (213 amino acids)

>BBR_RS19680 uracil phosphoribosyltransferase (Bifidobacterium breve UCC2003)
MELHVLNHPLVEHKLTVLRDKNTPSSTFRELVSELVMLEAYEATRNLSVVAAPIETPVAP
MTGKKLAKPRPIIVPVLRAGLGMLDGMTRLMPTAEVGFLGMKRDEEHPTQQVTYANRLPE
DLSGRQCFLIDPMLATGGTLVAATHYLAERGAKDVTAINIIAAPEGIKYVEEHIDPSIDF
KVVVCAVDEKLNDKCYIVPGLGDAGDRLYGVID