Protein Info for BBR_RS19625 in Bifidobacterium breve UCC2003

Annotation: 3-isopropylmalate dehydratase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00694: Aconitase_C
  • amino acids 1 to 114 (114 residues), 100.1 bits, E=6.5e-33
• TIGR00171: 3-isopropylmalate dehydratase, small subunit
  • amino acids 1 to 181 (181 residues), 199.8 bits, E=1.9e-63

Best Hits

Swiss-Prot: 99% identical to LEUD_BIFLS: 3-isopropylmalate dehydratase small subunit (leuD) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K01704, 3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC: 4.2.1.33 4.2.1.35] (inferred from 99% identity to bln:Blon_2324)

MetaCyc: 50% identical to 3-isopropylmalate dehydratase subunit LeuD (Escherichia coli K-12 substr. MG1655)
3-isopropylmalate dehydratase. [EC: 4.2.1.33]

Predicted SEED Role

"3-isopropylmalate dehydratase small subunit (EC 4.2.1.33)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 4.2.1.33)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• L-leucine biosynthesis (6/6 steps found)
• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• L-isoleucine biosynthesis II (6/8 steps found)
• 2,5-xylenol and 3,5-xylenol degradation (1/13 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• C5-Branched dibasic acid metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.33, 4.2.1.35

Use Curated BLAST to search for 4.2.1.33 or 4.2.1.35

Protein Sequence (229 amino acids)

>BBR_RS19625 3-isopropylmalate dehydratase small subunit (Bifidobacterium breve UCC2003)
MEKLTTLTGVGVPLRRSNVDTDQIIPAVFLKRVTKSGFDDALFYAWRRDPNFVLNKPEYA
GKGQILVAGPEFGIGSSREHAVWALHDYGFRVVIAPSFADIFYGNTAKNGVLAAIMPQES
VELLWKLLEEEPGREMTVSLETRTVTCGDMTLPFEVNDYVRWRLMNGYDDIDLTLQHEDD
IAAYEKMRAEKFPFKPKTIPAKHWPEEKIESAREPEDNWTGPLADRGII