Protein Info for BBR_RS19595 in Bifidobacterium breve UCC2003

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 120 (109 residues), 44.8 bits, see alignment E=7.3e-16 PF00528: BPD_transp_1" amino acids 35 to 227 (193 residues), 80.5 bits, see alignment E=6.8e-27

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 58% identity to bad:BAD_1258)

Predicted SEED Role

"Cysteine ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>BBR_RS19595 amino acid ABC transporter permease (Bifidobacterium breve UCC2003)
MTLDYEFMGQDIPVLLRALPATITLTLWSMLVALLFAVACGAFILVRIPVLKQLVIVINT
FIKGVPLVIQLLFCYYAVPIVAKGLDGFLGYHFDPRNPPYFPAAVLALGLNFGAYITDVV
VSSVRAIDHGQIEAGKACGMRRREIIWHILLPQVVVVSIPDMGNYFIWLLKGTSVASLVG
VVELLGTAKISASQNYDFLEAYLVAALLYWVVCVVAEWLLNLLYARLGKFNIKEDDAMQQ
FSFFFLSKQAKSKLRRKVYVIA