Protein Info for BBR_RS19590 in Bifidobacterium breve UCC2003

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 50 to 77 (28 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 139 to 144 (6 residues), see Phobius details amino acids 165 to 181 (17 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 116 (102 residues), 52.3 bits, see alignment E=3.3e-18 PF00528: BPD_transp_1" amino acids 49 to 215 (167 residues), 51.5 bits, see alignment E=5.3e-18

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 39% identity to ssp:SSP0619)

Predicted SEED Role

"amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>BBR_RS19590 ABC transporter permease (Bifidobacterium breve UCC2003)
MDSGLQIIVNVLPGMLQYVPMTLVYTLAPSIIAAILAVFICQARLRGTGVVYWLVSLFVS
FFRGTPQLVQLFLILYGLPRLLLIIGIDINDWSAGTFYIIATTLNLSCFVAEAYRGGYLA
MDYRQIEAGYSIGFSRLQCFFHVIVPGTLQNAVLNLKNLSIDVLKGASLAYTIGAIEVMG
YADRMIGLNSGVGRLWVLGVAAVIYFVLVAILELLFNLAAKHYQRYGKA