Protein Info for BBR_RS19580 in Bifidobacterium breve UCC2003

Annotation: pyridine nucleotide-disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 3 to 309 (307 residues), 202.3 bits, see alignment E=5.3e-63 PF13434: Lys_Orn_oxgnase" amino acids 74 to 172 (99 residues), 24.3 bits, see alignment E=7.5e-09 PF13738: Pyr_redox_3" amino acids 102 to 283 (182 residues), 31.4 bits, see alignment E=5.6e-11 PF00070: Pyr_redox" amino acids 154 to 232 (79 residues), 65.6 bits, see alignment E=2.2e-21 PF02852: Pyr_redox_dim" amino acids 332 to 431 (100 residues), 27.5 bits, see alignment E=1.3e-09

Best Hits

Swiss-Prot: 51% identical to NAOX_ENTFA: NADH oxidase (nox) from Enterococcus faecalis (strain ATCC 700802 / V583)

KEGG orthology group: K00356, NADH dehydrogenase [EC: 1.6.99.3] (inferred from 96% identity to blo:BL1266)

Predicted SEED Role

"FAD-dependent pyridine nucleotide-disulphide oxidoreductase"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>BBR_RS19580 pyridine nucleotide-disulfide oxidoreductase (Bifidobacterium breve UCC2003)
MTTVAVIGCTHAGTFAATSILAEHPDWTVHVFERNGTLSFLSCGIALWVGDHVSDPKKMF
YSSPAALAEAGATMHMRTDVTDVDLDAKTLTYRSLEDGDAATEQTLAFDKLVVTTGSRPV
IPPIPGIDSPHVLLCKNWDHAIAIKEKAKTAKSAVVIGSGYIGAEIAEQFSVTGVKTTLV
DGLDRPLANNFDKTITDQVAAAFEEHGVTLALGQKVVEFHDNDDNTVTVVTEKGEYTAEM
AILAVGFLPNTGLLKGKVDMLPNGAIVVDDYMQASVPDVYAAGDSATVFYNPTGQHDYIP
LATNAVRQGLLVGRNIEAPTVKYLGTQATSAVQLYDLSLAASGLTRAGAERRGLTVHETS
LTEDYRPDFMLTTTPVTSILTWDPETRKVKGGQFCSKADISGAANVISMAIQAGFTIDQL
ANVDFLFQPNFDKPVYYVGAVAMKAAAE