Protein Info for BBR_RS19570 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 50 to 74 (25 residues), see Phobius details amino acids 86 to 119 (34 residues), see Phobius details amino acids 169 to 197 (29 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details amino acids 326 to 351 (26 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details PF05977: MFS_3" amino acids 11 to 407 (397 residues), 53.8 bits, see alignment E=1.2e-18 PF07690: MFS_1" amino acids 22 to 371 (350 residues), 78.6 bits, see alignment E=4.5e-26

Best Hits

KEGG orthology group: None (inferred from 89% identity to blm:BLLJ_1760)

Predicted SEED Role

"Permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>BBR_RS19570 MFS transporter (Bifidobacterium breve UCC2003)
MQRKNDNSPQRPPRSRDFVLLVAGQGISLFGNMMLRFAMSMWVLDETGSATVFASVLAIS
IVPTILLSPFGGVLADRVNRRTIMVALDAISATLVLASAIVFAAAGFNIAAIATMQVLLA
VLGAFETPTVQAALPQMFRQYGPATMRQGMAVINQVQQLSSLLPSFLGGVLYAMFGIRLM
MIITIVSFAGAAALECFIRLSAPDRGDEELPTPIEDLKAGIRFLVKDRPNVFKLLLFSAA
LNFVLIGYSGVGFPYTIRTVLGFNATVYGIADGLIGVSGVAGAFIAGLFAAKLTMRWLPG
LMAALALAMVPQGIVFLLPVGAWTKLMILIIFTCGTMIASCFTNLIAVPTIQLNTPEAMT
GKVMSMAAAVSMCAQPLGQMVYGWAYDRMPVAAVLFISTVLFGIITAMLVPLSKQFED