Protein Info for BBR_RS19545 in Bifidobacterium breve UCC2003

Annotation: PTS glucose-like IIB component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details TIGR00826: PTS system, glucose-like IIB component" amino acids 46 to 137 (92 residues), 61.5 bits, see alignment E=3.7e-21 PF00367: PTS_EIIB" amino acids 80 to 112 (33 residues), 55 bits, see alignment 2.1e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>BBR_RS19545 PTS glucose-like IIB component (Bifidobacterium breve UCC2003)
MSGFNFSAGLVDFVLGWPLATKPYMLIVQGLVFAVIYYFVFDFAIRKFNLMTPGREAEEV
AAVDEAPAAGEDKYITMASRIYAALGGASNVKSIENCTTRLRLVVNDTSLVDQDAIKKTG
VPAVKVLDKTNLQVIVGTDVQFVADAMNDIAKGVTVGGDAAPKA