Protein Info for BBR_RS19510 in Bifidobacterium breve UCC2003

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 90 to 114 (25 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 184 to 209 (26 residues), see Phobius details amino acids 230 to 247 (18 residues), see Phobius details amino acids 259 to 284 (26 residues), see Phobius details amino acids 318 to 342 (25 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details amino acids 413 to 437 (25 residues), see Phobius details amino acids 444 to 465 (22 residues), see Phobius details PF02687: FtsX" amino acids 96 to 214 (119 residues), 31.5 bits, see alignment E=7.8e-12

Best Hits

KEGG orthology group: None (inferred from 99% identity to bln:Blon_2311)

Predicted SEED Role

"Phosphotransferase system, mannitol-specific IIBC component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>BBR_RS19510 ABC transporter permease (Bifidobacterium breve UCC2003)
MSAFALWRLFHRPGSRGSAGHTSVLAIIAFAAATTIFLTVLGGVHGFMWRASADHTIGCA
INLDACKPGTAEIWKQRIANPHSLDQYATAYVVLAFFACLLLIVPFVALAGSAARLAASR
RDARLASLRLAGATTGQVIRLTALDAAGQALVGALIGIAGYCVLIPLIMLLHFQNQTFTF
EQLWVGPIALIITLVGVTVLALISSLVTLRRVAITPLGVTSRVATTLPSGWRVVVFAVIM
VIAVLLFKNPMVLAQAGEVVMYGVIIGFMLLCFALVNLVGSWVVTARAKAKAKRPKDAAT
MIAMRRILDNPKRAWRNVSGIALAVFIAGITSICGFFGSAAVVGDANDPSTVFIRDIGTG
GILTLVFAAVLAAVSSGVMQAGSVYDQAGEYRMLVLEGTDVKTLNRARFIEVLTPLNIVV
IVAGGCSMLLMAPLFAASMTEPATLASFFGGLVLCYALVSVGAFASNRVAASLNLADYRA
DD